PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK07482.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NF-YB
Protein Properties Length: 227aa    MW: 24816.2 Da    PI: 7.2135
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK07482.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB179.72.5e-5626121297
      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                +eqd+flPianvsrimkk lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv plkvyl+kyre+e+ek
  PK07482.1  26 KEQDKFLPIANVSRIMKKSLPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFENYVGPLKVYLNKYREVEEEK 121
                89*******************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.8E-5324135IPR009072Histone-fold
SuperFamilySSF471139.16E-4128138IPR009072Histone-fold
PfamPF008082.9E-273195IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.9E-205977No hitNo description
PROSITE patternPS0068506278IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006158.9E-207896No hitNo description
PRINTSPR006158.9E-2097115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MSSKRNQTSS SSSPIGSPSS PDSLSKEQDK FLPIANVSRI MKKSLPANAK ISKEAKETVQ  60
ECVSEFISFI TGEASDKCQR EKRKTINGDD LLWAMTTLGF ENYVGPLKVY LNKYREVEEE  120
KNSMAIARQE ENSPTHTTTT PSHTFPNNKV DFQNFSVGGF YSVGGPKSYN IGEINGMANI  180
GYGDNNNYMN GIHETTITTT TTTGVGGDHG NPNRAVVAAQ LHHHGNX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-4826116292Transcription factor HapC (Eurofung)
4g92_B3e-4826116292Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010099896.11e-83Nuclear transcription factor Y subunit B-3
TrEMBLW9RLN51e-83W9RLN5_9R
STRINGGLYMA05G31681.15e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.18e-63nuclear factor Y, subunit B3